Results for : exercise

My landlord son is really good in bed

3.1k 82% 15min - 480p

My roommate needs extra help with stretching out

22.3k 92% 10min - 1440p

I called my personal trainer to give me a lesson at home, just so I could screw him over later.

3.3k 81% 16min - 1080p

Mature cutie Tina Kay from the UK ends her daily exercises in a masturbatorial frenzy (brand NEW video available in Full HD 1080P). Bonus video: English mature Tanya Cox.

106.6k 100% 12min - 1080p

Fine big ass girl pov workout on hotel bed

3.3k 82% 5min - 1080p

Pick me up 1

12.3k 78% 7min - 1080p

MY STEPSISTER'S FRIEND ENTERS MY ROOM

3.4k 82% 17min - 1440p

Big Assed Fit Milf Gives Gym Enthusiast Stud A Personal Training And Swallows His Protein Shot

740.8k 100% 15min - 720p

Having sex with my girlfriend's best friend is the best, and even better with a really beautiful friend like TanTaly.

9.2k 82% 13min - 1440p

I performed 2 more new for me exercises and it looks good :) Day 13 of naked yoga.

50.1k 93% 18min - 1080p

naughty hank panky party

2k 11sec - 1080p

Akari Minase Micro Thong Wedgie and Cameltoe

22k 82% 2min - 1080p

Amateur teen exercises wearing bikini

56.1k 93% 10min - 720p

Hot Chicks Anna & Mellisa Hard Threeway Sex - LETSDOEIT

184.2k 98% 17min - 1080p

How do you like it?? Grab me hard, me, pull my hair and eat my pussy.

3.3k 81% 12min - 720p

With My Gay Friend He Cheated on Me and Ended Up Fucking Me Really Rich What a Cock He Has

36.4k 97% 20min - 1080p

Mai Hoshikawa in micro bikini doing yoga in her room

36.7k 95% 2min - 1080p

Horny Babe Maina Yuri showing her boobs while workout

21.1k 96% 2min - 1080p

The Gym Trainer

91.8k 85% 6min - 1080p

Compilation of super horny Apolonia putting toys in her tight pussy

6.1k 82% 10min - 1080p

Cumshots Are the Best Medicine (New Milf Alert: Ruby Lynne)

62.3k 93% 1min 42sec - 720p

Julia Jumps on a dildo, snuggle up to me and cum

4.5k 82% 10min - 1080p

Slender Beauty Rika Exercises with Her Boobs Exposed in a Micro Bikini

19.4k 87% 2min - 1080p

Riley Jacobs has an amazing hot body that she keeps in great shape

201.1k 99% 11min - 1080p

GALS APARTMENT New Girl Akari Minase Part 1

144.5k 100% 10min - 1080p

I decided to try YOGA as my daily exercises. Looking forward to results :) Day 1.

50.9k 90% 10min - 1080p

Hunghank69 - update #29 - D1LVPointplateshimmyweirdfaceweirderface - Jul 29, 2025

1.5k 19sec - 1080p

Beautiful young girl gets angry because she is woken up to fuck and suck her pink pussy early in the morning

6.2k 31min - 1080p

**Odalis Rosado gets hot in the kitchen | A couple's encounter that raises the temperature**

1.8k 81% 11min - 1080p

MERCHANDISING: THIS GROUP THROWS SLUTTY PARTIES ONLY WITH 18-YEAR-OLD GIRLS, THE GROUP'S NAME IS "TOGETHER AND MIXED".

2.4k 11min - 720p

The Second Massage

2.5k 18min - 1440p