Results for : exercise balling

The Gym Trainer

91.9k 85% 6min - 1080p

I decided to try YOGA as my daily exercises. Looking forward to results :) Day 1.

50.9k 90% 10min - 1080p

I Discover My Stepsister Uploading Porn Content and I Take the Advantage of Fucking Her in Front of Her Followers

23k 98% 20min - 1080p

Compilation of super horny Apolonia putting toys in her tight pussy

6.1k 82% 10min - 1080p

Hot private session! Conny Rous is seduced by her trainer and they end up having sex

2.4k 81% 11min - 1080p

Hunghank69 - update #29 - D1LVPointplateshimmyweirdfaceweirderface - Jul 29, 2025

1.5k 19sec - 1080p

I called my personal trainer to give me a lesson at home, just so I could screw him over later.

3.3k 81% 16min - 1080p

The Real Workout - (Aaliyah Hadid) Got Good Meditate To Good Sex

637.2k 99% 12min - 720p

Cumshots Are the Best Medicine (New Milf Alert: Ruby Lynne)

62.7k 94% 1min 42sec - 720p

Good Mouth Workout For Hot Black Model With Blonde Hair, Msnovember Sucking Thick Dick Wrapping Her Tight Lips Around That Big Pole Until She Release His Explosive Load Down Her Cute Chin HD Erotica By Sheisnovember

218.5k 75% 3min - 1080p

Naked girl getting dressed while showing her boobs

143.6k 97% 2min - 1080p

Fine big ass girl pov workout on hotel bed

3.4k 82% 5min - 1080p

Pick me up 1

12.4k 78% 7min - 1080p

The Real Workout - Ebony Personal Trainer Amethyst Banks Intense Workout

2.8M 100% 10min - 720p

PART 1 - Hot scenes from a visit from Minas Gerais to the black guy's house in Copacabana, an ass will be ripped open with screams and moans...

9.5k 93% 8min - 720p

Big Assed Fit Milf Gives Gym Enthusiast Stud A Personal Training And Swallows His Protein Shot

741.9k 100% 15min - 720p

With My Gay Friend He Cheated on Me and Ended Up Fucking Me Really Rich What a Cock He Has

36.5k 97% 20min - 1080p

Unlock Your Multiple Cumshot Potential: Take Our Step-by-Step Course

4.2k 7min - 1440p

MERCHANDISING: THIS GROUP THROWS SLUTTY PARTIES ONLY WITH 18-YEAR-OLD GIRLS, THE GROUP'S NAME IS "TOGETHER AND MIXED".

2.5k 11min - 720p

Latina Slut Wife Masturbates And Films Herself For Her Husband's Friends In Illinois Usa 1

9.1k 83% 5min - 1080p

Julia performs at very first time normal plan of exercises (usually it's hard). Day 22 of Face Fitness.

40.7k 80% 10min - 1080p

My Neighbor Has a Huge Pussy I Love to Fuck Her Beautiful Unprotected Pussy 2

13.5k 85% 5min - 1080p

Japanese girl undressing in front of hidden camera

127.9k 87% 2min - 720p

up you are here

4.5k 74% 6min - 1080p

Amateur teen exercises wearing bikini

56.2k 93% 10min - 720p

Japanese Girl Naked and Natural Tits

40.8k 86% 1min 21sec - 1080p

All natural hottie Alexa Tomas does her best to take Antonio Black’s massive black cock! He fills her ass with his hard tool before cumming on her! Full Flick & 1000s More at PrivateBlack.com!

1.4M 100% 13min - 1080p

Two Best Friend Fingers

900k 100% 11min - 720p

Riley Jacobs has an amazing hot body that she keeps in great shape

201.5k 99% 11min - 1080p

Julia Jumps on a dildo, snuggle up to me and cum

4.6k 82% 10min - 1080p